PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_05373A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 377aa    MW: 40243.9 Da    PI: 10.3634
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_05373AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591.1e-183782147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               +g+WT++Edell +av ++G ++W+ I ++++ gR++k+c++rw + 
  Oropetium_20150105_05373A 37 KGSWTPQEDELLRRAVDRHGARNWSVIGAEVP-GRSGKSCRLRWCNQ 82
                               799*****************************.***********985 PP

2Myb_DNA-binding53.94.2e-1789133147
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                r ++T++Ed  +v a++++G++ W+tIar +  gRt++++k++w++ 
  Oropetium_20150105_05373A  89 RRPFTPDEDAVIVAAHARYGNK-WATIARLLH-GRTDNSVKNHWNST 133
                                679*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.0573287IPR017930Myb domain
SuperFamilySSF466891.58E-2934130IPR009057Homeodomain-like
SMARTSM007177.8E-163685IPR001005SANT/Myb domain
PfamPF002492.4E-183782IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-233890IPR009057Homeodomain-like
CDDcd001677.06E-153981No hitNo description
SMARTSM007176.4E-1488136IPR001005SANT/Myb domain
PfamPF002498.1E-1489133IPR001005SANT/Myb domain
PROSITE profilePS5129419.69789138IPR017930Myb domain
CDDcd001671.14E-1091134No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2291136IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MVVPGVKPSS TRSGVGVDSX XXXXXXXXXA AAAGRVKGSW TPQEDELLRR AVDRHGARNW  60
SVIGAEVPGR SGKSCRLRWC NQLSPGVERR PFTPDEDAVI VAAHARYGNK WATIARLLHG  120
RTDNSVKNHW NSTLRRHRRA AAAASAAAAG AASSAGCAAE MPHLDEDAPI LSSSTLLDRI  180
KDLPPPPPQS FLAPVPFPPL DHRPKENXXX XXXXXXXXXX XXXXXXXXXG SSEDSVLAPP  240
PPPPKKKRMC THHQLLPVPL PLDVTKPAEQ TTNPPPPPPP EPVTSLTLSP PGGGGGSVVP  300
AGASSTESLA EMRAKMEEDP LFLPVMRRMI VEEVHRVMGM MQPPPPGGLA FSVQPMAASA  360
SRRADGGHPR NGRPTG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C8e-34361363103C-Myb DNA-Binding Domain
1mse_C8e-34361363103C-Myb DNA-Binding Domain
1gv2_A9e-34361363103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9698546e-94EU969854.1 Zea mays clone 336503 mRNA sequence.
GenBankKJ7276596e-94KJ727659.1 Zea mays clone pUT5586 MYB transcription factor (MYB119) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439611.19e-76hypothetical protein SORBIDRAFT_09g016570
TrEMBLC5YWC01e-75C5YWC0_SORBI; Putative uncharacterized protein Sb09g016570
STRINGSb09g016570.13e-75(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.11e-51myb domain protein 77